ExPASy logo ExPASy Home page Site Map Search ExPASy Contact us PROSITE
Search for

ScanProsite Results Viewer

This view shows ScanProsite results together with ProRule-based predicted intra-domain features (help).

show hits of frequently occuring signatures
Hits for all PROSITE (release 20.19) motifs on sequence USERSEQ1 :

found: 2 hits in 1 sequence

USERSEQ1 (63 aa)
MCMCRPCKVRLFDLIFSQARTRSPCQMPCLLCSPPVFVFFEWPCPKPGLMRNHTGCPGLTAPN



hits by patterns with a high probability of occurrence or by user-defined patterns: [2 hits (by 2 distinct patterns) on 1 sequence]


USERSEQ1 USERSEQ1 hits48 - 53: MYRISTYL 52 - 55: ASN_GLYCOSYLATION     (63 aa)


PS00008   MYRISTYL   N-myristoylation site :
48 - 53:   GLmrNH
PS00001   ASN_GLYCOSYLATION   N-glycosylation site :
52 - 55:   NHTG










ExPASy logo ExPASy Home page Site Map Search ExPASy Contact us PROSITE