ScanProsite Results Viewer

This view shows ScanProsite results together with ProRule-based predicted intra-domain features (help).

show hits of frequently occuring signatures

Hits for all PROSITE (release 20.19) motifs on sequence USERSEQ1 :

USERSEQ1 (75 aa)

MSMEPQFTGIFSSTTRASVARSSRSAVNTMSACPLCKPGVKPLANARSISPKDTESTTTPCRFMRR
RICVLELAF

ruler:

hits by patterns with a high probability of occurrence or by user-defined patterns: [5 hits (by 3 distinct patterns) on 1 sequence]

USERSEQ1		(75 aa)

PS00008 MYRISTYL N-myristoylation site :

9 - 14:	GIfsST

PS00005 PKC_PHOSPHO_SITE Protein kinase C phosphorylation site :

14 - 16:	TtR

22 - 24:	SsR

50 - 52:	SpK

PS00006 CK2_PHOSPHO_SITE Casein kinase II phosphorylation site :

50 - 53:	SpkD