ScanProsite Results Viewer

This view shows ScanProsite results together with ProRule-based predicted intra-domain features (help).

show hits of frequently occuring signatures

Hits for all PROSITE (release 20.19) motifs on sequence USERSEQ1 :

found: 11 hits in 1 sequence

USERSEQ1 (180 aa)

MALGVCLSMETFAEPVFSNDLLAKAESGDTSAQLELAEIYLYGHGVDSDENQAEIWAIKSAENGNV
AAMFWLADGYVTYARLIEDDDKNDSLEHFQKAFKWFQKASENGHSESMVELADLYTRADSGIEVNI
KKALELREKAAKLGNKKAMRSLSVMYRDGIGIPKNTDLAQSWWDKSEN

ruler:

hits by patterns with a high probability of occurrence or by user-defined patterns: [11 hits (by 3 distinct patterns) on 1 sequence]

USERSEQ1		(180 aa)

PS00008 MYRISTYL N-myristoylation site :

4 - 9:	GVclSM

64 - 69:	GNvaAM

127 - 132:	GIevNI

146 - 151:	GNkkAM

163 - 168:	GIpkNT

PS00006 CK2_PHOSPHO_SITE Casein kinase II phosphorylation site :

11 - 14:	TfaE

113 - 116:	SmvE

122 - 125:	TraD

126 - 129:	SgiE

173 - 176:	SwwD

PS00001 ASN_GLYCOSYLATION N-glycosylation site :

89 - 92:	NDSL